] }, } "context" : "envParam:quiltName", count++; } Einzigartige UHD-Qualität mit Deinem neuen Sky Q Receiver, Mit Sky Q genießt Du maximale Freiheit. } "actions" : [ { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_13","feedbackSelector":".InfoMessage"}); "context" : "envParam:quiltName", "context" : "envParam:quiltName,expandedQuiltName", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_8","feedbackSelector":".InfoMessage"}); { }); // We made it! LITHIUM.MessageBodyDisplay('#bodyDisplay_1', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); if ( neededkeys[count] == key ) { }, "action" : "rerender" "context" : "", "event" : "MessagesWidgetAnswerForm", }, }, "event" : "editProductMessage", "actions" : [ if ( watching ) { "context" : "", "truncateBody" : "true", .attr('aria-selected','true'); "quiltName" : "ForumMessage", }); "disallowZeroCount" : "false", createStorage("true"); "displaySubject" : "true", "actions" : [ "action" : "rerender" { "action" : "rerender" "displayStyle" : "horizontal", { "context" : "", "useSimpleView" : "false", }); { // Set start to true only if the first key in the sequence is pressed { "event" : "RevokeSolutionAction", { "message" : "2497943", ] "event" : "MessagesWidgetCommentForm", "context" : "", } { GigaKombi-Rabatt bei Anscluss über Hausgemeinschaf... Ich weiss nicht wo ich anfangen soll .... Fernseh ... Meine Kabel-Deutschland Kundennummer wird nicht er... Kabel Internet Leitung in der Wohnung prüfen, Vorschläge deaktivieren"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_862365dcc14513_0","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.messagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/123456/thread-id/223576&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "context" : "", "action" : "rerender" } }, else { "message" : "2497394", "event" : "ProductMessageEdit", }); $('.css-menu').removeClass('cssmenu-open') "revokeMode" : "true", "actions" : [ Bist du sicher, dass du fortfahren möchtest? /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ } "event" : "approveMessage", "closeEvent" : "LITHIUM:lightboxCloseEvent", }); Vodafone stellt über sein Kabelnetz nicht nur Kabelfernsehen, sondern auch über 350 Radiosender bereit. { "disallowZeroCount" : "false", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "action" : "rerender" } ] ] "event" : "ProductAnswer", { var handleOpen = function(event) { "actions" : [ // just for convenience, you need a login anyways... } } "eventActions" : [ LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; }, } Bei weiteren Fragen und Unklarheiten solltest Du am besten direkt Deinen Kabelanbieter kontaktieren. "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", { .attr('aria-expanded','false'); }, "event" : "deleteMessage", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "actions" : [ "useCountToKudo" : "false", { "context" : "envParam:quiltName,message", ] "actions" : [ "initiatorDataMatcher" : "data-lia-kudos-id" LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2497943 .lia-rating-control-passive', '#form_1'); ], LITHIUM.Dialog({ "event" : "MessagesWidgetCommentForm", "closeImageIconURL" : "https://forum.vodafone.de/skins/images/EE4ADC993AA021EAB7DE192BDBFD2A95/responsive_peak/images/button_dialog_close.svg", } notifCount = parseInt($(this).html()) + notifCount; }, } LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; { } { // Set start to true only if the first key in the sequence is pressed LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_10","feedbackSelector":".InfoMessage"}); } { }, }, und die Sky Marken sind Marken von Sky International AG und werden in Lizenz genutzt. }, //if(height > 430) { Private HD Sender über Sky Q ‎13.12.2020 20:55 Hallo, ich habe einen Sky Q Receiver zu Hause mit dem entsprechenden Abo von Sky und würde gerne die privaten Sender, wie z.B. "action" : "rerender" ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, element.children('ul').slideDown(); }, "message" : "2497943", ;(function($) { { "entity" : "2497943", } ', 'ajax'); }, LITHIUM.AjaxSupport.fromForm('#form_1', 'GiveRating', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "actions" : [ }, } "parameters" : { { } "event" : "addMessageUserEmailSubscription", }); "action" : "rerender" "componentId" : "forums.widget.message-view", LITHIUM.Dialog.options['-1180788162'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "event" : "deleteMessage", { LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; }, { "actions" : [ "context" : "", LITHIUM.Cache.CustomEvent.set([{"elementId":"link_5","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2497394}},{"elementId":"link_9","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2497603}},{"elementId":"link_13","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2497943}},{"elementId":"link_16","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2581614}},{"elementId":"link_17","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2586982}},{"elementId":"link_18","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2601146}},{"elementId":"link_19","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2601034}},{"elementId":"link_20","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2600873}},{"elementId":"link_22","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2602407}},{"elementId":"link_23","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2602311}},{"elementId":"link_24","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2602222}},{"elementId":"link_25","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2602220}},{"elementId":"link_26","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2602149}},{"elementId":"link_27","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2602061}},{"elementId":"link_28","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2602042}},{"elementId":"link_29","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2602012}},{"elementId":"link_30","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2602007}},{"elementId":"link_31","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2601861}}]); "context" : "envParam:entity", "actions" : [ ] { "event" : "MessagesWidgetEditAnswerForm", }, "closeImageIconURL" : "https://forum.vodafone.de/skins/images/EE4ADC993AA021EAB7DE192BDBFD2A95/responsive_peak/images/button_dialog_close.svg", "event" : "ProductAnswer", setCookie: function(cookieName, cookieValue) { Sky Kabel Vodafone Aktion: Starter + Cinema + HD 5,00 Euro / Monat Mobile: Red XS mit 6GB, 5 Euro Rabatt + Selbstständigen Rabatt + 2 OneNumber SimCard's für den Preis von Einer + 19% "Rabatt" auf alles + VIP/Platin Status inkl. "triggerSelector" : ".lia-panel-dialog-trigger-event-click", "context" : "envParam:feedbackData", "event" : "MessagesWidgetMessageEdit", "initiatorBinding" : true, "eventActions" : [ { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_0","feedbackSelector":".InfoMessage"}); "context" : "", "actions" : [ } { { $('#node-menu li.has-sub>a').on('click', function(){ "event" : "MessagesWidgetAnswerForm", } RTL oder Pro Sieben in HD empfangen, aber ohne einen weiteren Receiver an meinen Fernseher anzuschließen. $(this).toggleClass("view-btn-open view-btn-close"); "event" : "ProductAnswer", } "useCountToKudo" : "false", } }, "actions" : [ "actions" : [ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:userExistsQuery","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#userSearchField_862365dcc14513","action":"userExistsQuery","feedbackSelector":"#ajaxfeedback_862365dcc14513_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield:userexistsquery?t:ac=board-id/123456/thread-id/223576&t:cp=search/contributions/page","ajaxErrorEventName":"LITHIUM:ajaxError","token":"iIFME1gE7Jhaa6-i_mgjGXFl2qXFiQgTq0ze_68z-IM. { "event" : "MessagesWidgetAnswerForm", "action" : "rerender" ] { "event" : "kudoEntity", "messageViewOptions" : "1111110111111111111110111110100101011101" { } { window.onclick = function(event) { "message" : "2497943", }, .attr('aria-hidden','true') })(LITHIUM.jQuery); "event" : "expandMessage", "event" : "MessagesWidgetEditCommentForm", LITHIUM.Loader.runJsAttached(); "actions" : [ Informationen dazu findet Ihr im Beitrag Paket-SMS-Trojaner, Kabel:  Ausfall des Senders Channel One Russia in Niedersachsen und Bremen, Nähere Informationen dazu findet Ihr im Eilmeldungsboard. } ] "context" : "envParam:quiltName,message,product,contextId,contextUrl", '; "displayStyle" : "horizontal", { ;(function($){ }, } ;(function($) { $(document).ready(function(){ event.returnValue = false; { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "triggerEvent" : "click", watching = false; watching = false; "eventActions" : [ var clickHandler = function(event) { "initiatorBinding" : true, "forceSearchRequestParameterForBlurbBuilder" : "false", $(document).ready(function(){ ] Einfach. LITHIUM.SearchAutoCompleteToggle({"containerSelector":"#searchautocompletetoggle_862365dcc14513","enableAutoCompleteSelector":".search-autocomplete-toggle-link","enableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:enableAutoComplete","disableAutoCompleteSelector":".lia-autocomplete-toggle-off","disableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:disableAutoComplete","autoCompleteSelector":".lia-autocomplete-input"}); "event" : "AcceptSolutionAction", ] "event" : "unapproveMessage", ', 'ajax');","content":"Vorschläge deaktivieren"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_862365dcc14513_1","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.tkbmessagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/123456/thread-id/223576&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); { "event" : "approveMessage", Bezgl. "event" : "expandMessage", "event" : "addMessageUserEmailSubscription", "event" : "AcceptSolutionAction", { "actions" : [ $('section.header-announcement').slideUp(); $('.menu-container').on('click','.community-node-menu-btn.active', {'selector' : '.css-node-menu' }, handleClose); "action" : "rerender" }); { } "action" : "rerender" "action" : "rerender" window.onload = function() { { } "actions" : [ "action" : "rerender" { { Meine Frage ist: Gibt es irgendeinen weg die privaten HD Sender über den Sky Receiver zu bekommen, wenn man Kabelkunde ist? } "disableKudosForAnonUser" : "false", "event" : "MessagesWidgetEditAnswerForm", "context" : "", "action" : "rerender" } }, })(LITHIUM.jQuery); $('#vodafone-community-header .lia-search-toggle').click(function() { "actions" : [ ] LITHIUM.AjaxSupport.ComponentEvents.set({ } { "context" : "", { }, event.preventDefault(); "action" : "rerender" "useSubjectIcons" : "true", { Über das Vodafone Kabelnetz kann die Buchung über verschiedene Wege erfolgen. logmein: [76, 79, 71, 77, 69, 73, 78], ] { "actions" : [ "context" : "lia-deleted-state", { LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; "actions" : [ LITHIUM.InputEditForm("form_0", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. }); "action" : "rerender" "showCountOnly" : "false", $('#vodafone-community-header .lia-button-wrapper-searchForm-action').toggleClass('active'); LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_1","menuItemsSelector":".lia-menu-dropdown-items"}}); }); if ( key == neededkeys[0] ) { }, "initiatorDataMatcher" : "data-lia-message-uid" ] }, "event" : "MessagesWidgetCommentForm", Execute whatever should happen when entering the right sequence "action" : "pulsate" "revokeMode" : "true", } }, var msg = $(".message-uid-2497943"); "action" : "rerender" { ] ] }, "actions" : [ "event" : "addThreadUserEmailSubscription", "event" : "MessagesWidgetAnswerForm", ] LITHIUM.InputEditForm("form_1", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. var key = e.keyCode; { } "context" : "", ] }, "action" : "rerender" "kudosable" : "true", "closeEvent" : "LITHIUM:lightboxCloseEvent", LITHIUM.StarRating('#any_0', true, 2, 'LITHIUM:starRating'); "}); "actions" : [ ","loaderSelector":"#lineardisplaymessageviewwrapper_0 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); Aber vielleicht schreibst du hier auch noch mal deinen Wohnort rein, nicht dass du in einem Ort wohnst, der teils ausgebaut und teils unausgebaut ist (das gibt es nämlich auch noch). } { { ","loaderSelector":"#lineardisplaymessageviewwrapper_1 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "event" : "editProductMessage", "context" : "envParam:quiltName", ], { if ( count == neededkeys.length ) { Bitte beachte: Das Programmangebot der empfangbaren TV- und Radiosender kann sich unterscheiden. }, "context" : "envParam:quiltName,message", LITHIUM.AjaxSupport.ComponentEvents.set({ { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_0","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/123456/thread-id/223576","ajaxErrorEventName":"LITHIUM:ajaxError","token":"oMF1dEavqtVsEjJ1qjCpMLtbTgbTnaK7a_G1M5SmX6I. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_2","feedbackSelector":".InfoMessage"}); { "action" : "rerender" { "showCountOnly" : "false", } "componentId" : "kudos.widget.button", Dazu mußt du dann da Basic TV Abo abschließen (eventuell kommt noch TV Connect dazu) und die Seriennummer der Sky Karte und des Sky Receiver mußt du auch parat haben. watching = true; { "context" : "envParam:feedbackData", if (element.hasClass('active')) { { "context" : "", "eventActions" : [ "disableLinks" : "false", "actions" : [ Das heißt, dass Sky Kunden mit Sky HD die HD-Sender der Pakete Sky Cinema, Sky Sport und Sky Fußball Bundesliga empfangen können. "actions" : [ { Vodafone West (ehem. $('section.header-announcement').slideUp(); })(LITHIUM.jQuery); LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/123456/thread-id/223576","ajaxErrorEventName":"LITHIUM:ajaxError","token":"7nzlek9iVrWfbcBTWsZGidb56DcMTljTaTaj5xYYm-o. "context" : "envParam:entity", { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "actions" : [ "action" : "rerender" ] $('#vodafone-community-header .lia-search-toggle').click(function() { { var neededkeys = [76, 79, 71, 77, 69, 73, 78]; "action" : "rerender" ] LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_1","componentSelector":"#lineardisplaymessageviewwrapper_1","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2497943,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "event" : "RevokeSolutionAction", function createStorage(option){ "event" : "ProductAnswerComment", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_2","menuItemsSelector":".lia-menu-dropdown-items"}}); { { Allerdings habe ich einen Kabelanschluss und kann dadurch kein HD+ über Sky buchen. }, } LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/123456/thread-id/223576","ajaxErrorEventName":"LITHIUM:ajaxError","token":"7nzlek9iVrWfbcBTWsZGidb56DcMTljTaTaj5xYYm-o. }, Soweit ich weiß gibt es noch keine Auslieferung der Giga Box bei Vodafone West, du erhältst weiterhin die Horizon Box oder CI Modul. { }); { "action" : "rerender" { "actions" : [ "message" : "2497394", "actions" : [ ] LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_2","menuItemsSelector":".lia-menu-dropdown-items"}}); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_7","feedbackSelector":".InfoMessage"}); { "action" : "rerender" "componentId" : "forums.widget.message-view", ] }, Darüber hinaus genießt Du mit HD+ über Sky unter anderem den Sportsender Sport1 und den Disney Channel im HD-Format. LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); "action" : "rerender" lithadmin: [] "actions" : [ } }); { { "}); So empfangen Kunden unterschiedlicher Kabelnetzanbieter zum Teil auch unterschiedliche Sender. im Kabel-/IPTV-Netz, abhängig vom jeweiligen Netzbetreiber empfangbar. "actions" : [ } if ( !watching ) { { { "action" : "rerender" } "actions" : [ "action" : "pulsate" $('.css-menu').removeClass('cssmenu-open') "context" : "", }, "action" : "rerender" "event" : "ProductAnswerComment", "parameters" : { "actions" : [ } "action" : "rerender" "dialogKey" : "dialogKey" // We're good so far. { count = 0; "activecastFullscreen" : false, /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "actions" : [ "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { sowohl über Kabel (das Angebot mit 5€ Gutschrift), als auch per IPTV – mit der Vodafone Hardware. "action" : "rerender" }, }; "event" : "RevokeSolutionAction", "action" : "rerender" LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; "initiatorBinding" : true, var count = 0; "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_11","feedbackSelector":".InfoMessage"}); "action" : "rerender" "action" : "rerender" LITHIUM.InputEditForm("form", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. }, }); { if ( key == neededkeys[0] ) { }; "actions" : [ "messageViewOptions" : "1111110111111111111110111110100101001101" Exklusiv für Vodafone Kunden im Kabelnetz, € 5 Preisvorteil auf ausgewählte Paketkombinationen*, Dein Sky Programm wird direkt auf Deiner Vodafone Smartcard freigeschaltet, Bereits Netflix-Kunde? "action" : "rerender" "useTruncatedSubject" : "true", { { }, "context" : "", } { "action" : "rerender" { LITHIUM.Dialog({ LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper","componentSelector":"#lineardisplaymessageviewwrapper","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2497394,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. resetMenu(); ] "quiltName" : "ForumMessage", "closeEvent" : "LITHIUM:lightboxCloseEvent", }, "action" : "rerender" "kudosLinksDisabled" : "false", { "actions" : [ "accessibility" : false, $('#user-menu .lia-header-nav-component-unread-count').each(function(e) { "triggerEvent" : "click", ], { } notifCount = parseInt($(this).html()) + notifCount; "accessibility" : false, LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_1","menuItemsSelector":".lia-menu-dropdown-items"}}); "truncateBodyRetainsHtml" : "false", var resetMenu = function() { ] var keycodes = { })(LITHIUM.jQuery); "actions" : [ $('.menu-container').on('click','.community-user-menu-btn.active', {'selector' : '.css-user-menu' }, handleClose); "action" : "rerender" $('#vodafone-community-header .lia-search-input-wrapper').fadeToggle() { $('.menu-container').on('click','.community-node-menu-btn.active', {'selector' : '.css-node-menu' }, handleClose); ', 'ajax'); "disableLinks" : "false", "action" : "rerender" { } "event" : "ProductAnswer", } "actions" : [ watching = false; "event" : "kudoEntity", .attr('aria-selected','false'); $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); LITHIUM.AjaxSupport.fromForm('#form_0', 'GiveRating', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); LITHIUM.Dialog({ }); "action" : "rerender" ] "event" : "MessagesWidgetEditAction", { VU+ Duo 4K mit DVB-C FBC Tuner und DVB-T2 HD Dual Tuner, \\n\\t\\t\\t\\n\\t\\n\\n\\t\\n\\n\\t\\t\";LITHIUM.AjaxSupport.defaultAjaxErrorHtml = \", \\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\t\\t\\t\\t\\t, '; "event" : "addThreadUserEmailSubscription", } "action" : "rerender" { "truncateBodyRetainsHtml" : "false", "context" : "envParam:quiltName,product,contextId,contextUrl", "defaultAriaLabel" : "", } "}); }); ', 'ajax'); .attr('aria-expanded','true'); { "action" : "rerender" { "truncateBody" : "true", } "context" : "", LITHIUM.AjaxSupport.fromLink('#kudoEntity', 'kudoEntity', '#ajaxfeedback', 'LITHIUM:ajaxError', {}, 'P1NPw2NuHWrhIHIZ0dBmglfFGXINlgfkiScmjTmkMak.